Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGLL Peptide - N-terminal region

MGLL Peptide - N-terminal region

Product Specifications

Product Name Alternative

HU-K5, MGL, HUK5, MAGL

UniProt

Q6IBG9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MGLL Rabbit Polyclonal Antibody (orb330677) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009214

Preservative

Lyophilized powder

AA Sequence

METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal LRPAP Antibody (011) [Biotin]
NBP2-90514B 0.1 mL

Rabbit Monoclonal LRPAP Antibody (011) [Biotin]

Sign In for Pricing
View Details
2-Formyl benzene sulfonamide
sc-335212 100 mg

2-Formyl benzene sulfonamide

Sign In for Pricing
View Details
ZWILCH (Zwilch, kinetochore Associated, Homolog (Drosophila), FLJ10036, FLJ16343, KNTC1AP, MGC111034, hZwilch) (AP)
MBS6163845-01 0.1 mL

ZWILCH (Zwilch, kinetochore Associated, Homolog (Drosophila), FLJ10036, FLJ16343, KNTC1AP, MGC111034, hZwilch) (AP)

Sign In for Pricing
View Details
ZWILCH (Zwilch, kinetochore Associated, Homolog (Drosophila), FLJ10036, FLJ16343, KNTC1AP, MGC111034, hZwilch) (AP)
MBS6163845-02 5x 0.1 mL

ZWILCH (Zwilch, kinetochore Associated, Homolog (Drosophila), FLJ10036, FLJ16343, KNTC1AP, MGC111034, hZwilch) (AP)

Sign In for Pricing
View Details
Setileuton (tosylate)
HY-10437A 1 Each

Setileuton (tosylate)

Sign In for Pricing
View Details
CACNG8 (NM_031895) Human Tagged Lenti ORF Clone
RC214485L3 10 µg

CACNG8 (NM_031895) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details