Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGST1 Peptide - N-terminal region

MGST1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GST12, MGC14525, MGST, MGST-I

UniProt

P10620

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MGST1 Rabbit Polyclonal Antibody (orb584645) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_665735

Preservative

Lyophilized powder

AA Sequence

NPEDCVAFGKGENAKKYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat TEK Tyrosine Kinase, Endothelial (Tie2) ELISA Kit
DLR-Tie2-Ra-48T 48 Tests

Rat TEK Tyrosine Kinase, Endothelial (Tie2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti Human IgM-AbFluor 680
SA1023-01 100 µL

Rabbit Anti Human IgM-AbFluor 680

Sign In for Pricing
View Details
Rabbit Anti Human IgM-AbFluor 680
SA1023-02 1 mL

Rabbit Anti Human IgM-AbFluor 680

Sign In for Pricing
View Details
Trpt1 (NM_001106331) Rat Tagged Lenti ORF Clone
RR212486L3 10 µg

Trpt1 (NM_001106331) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MKLP-1 (h) : 293T Lysate
sc-113424 100 µg - 200 µL

MKLP-1 (h) : 293T Lysate

Sign In for Pricing
View Details
p53 Antibody
MBS9613766-01 0.1 mL

p53 Antibody

Sign In for Pricing
View Details