Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGST3 Peptide - N-terminal region

MGST3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GST-III

UniProt

O14880

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MGST3 Rabbit Polyclonal Antibody (orb584646) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004519

Preservative

Lyophilized powder

AA Sequence

LAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Renin (REN)
TRV-0049076-01 20 µL

Polyclonal Antibody to Renin (REN)

Sign In for Pricing
View Details
Polyclonal Antibody to Renin (REN)
TRV-0049076-02 100 µL

Polyclonal Antibody to Renin (REN)

Sign In for Pricing
View Details
Polyclonal Antibody to Renin (REN)
TRV-0049076-03 200 µL

Polyclonal Antibody to Renin (REN)

Sign In for Pricing
View Details
Polyclonal Antibody to Renin (REN)
TRV-0049076-04 1 mL

Polyclonal Antibody to Renin (REN)

Sign In for Pricing
View Details
CAF1A antibody
MBS5300611-01 0.1 mg

CAF1A antibody

Sign In for Pricing
View Details
CAF1A antibody
MBS5300611-02 5x 0.1 mg

CAF1A antibody

Sign In for Pricing
View Details