Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGST3 Peptide - N-terminal region

MGST3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GST-III

UniProt

O14880

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MGST3 Rabbit Polyclonal Antibody (orb584646) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004519

Preservative

Lyophilized powder

AA Sequence

LAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NARG1L (NAA16) Rabbit Polyclonal Antibody
TA346824 100 µL

NARG1L (NAA16) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Geminin Antibody (GMNN/3665) [Janelia Fluor 635]
NBP3-14128JF635 0.1 mL

Mouse Monoclonal Geminin Antibody (GMNN/3665) [Janelia Fluor 635]

Sign In for Pricing
View Details
Amplite® Fluorimetric Oxaloacetate Assay Kit *Red Fluorescence*
13841-AAT 200 Tests

Amplite® Fluorimetric Oxaloacetate Assay Kit *Red Fluorescence*

Sign In for Pricing
View Details
FPGT rabbit pAb
MBS8601099-01 0.1 mL

FPGT rabbit pAb

Sign In for Pricing
View Details
FPGT rabbit pAb
MBS8601099-02 0.1 mL (AF405L)

FPGT rabbit pAb

Sign In for Pricing
View Details
FPGT rabbit pAb
MBS8601099-03 0.1 mL (AF405S)

FPGT rabbit pAb

Sign In for Pricing
View Details