Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICAL1 Peptide - C-terminal region

MICAL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp434B1517, FLJ11937, FLJ21739, MICAL, MICAL-1, NICAL

UniProt

Q8TDZ2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MICAL1 Rabbit Polyclonal Antibody (orb585173) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001152763

Preservative

Lyophilized powder

AA Sequence

WQLDQELRGYMNREENLKTAADRQAEDQVLRKLVDLVNQRDALIRFQEER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Bronchial Epithelial Cells (DF508/N1303K Cystic Fibrosis)
ARP1162 0.5 Million

Human Bronchial Epithelial Cells (DF508/N1303K Cystic Fibrosis)

Sign In for Pricing
View Details
Recombinant Rat Kitlg
P4909-01 50 µg

Recombinant Rat Kitlg

Sign In for Pricing
View Details
Recombinant Rat Kitlg
P4909-02 200 µg

Recombinant Rat Kitlg

Sign In for Pricing
View Details
Recombinant Rat Kitlg
P4909-03 1 mg

Recombinant Rat Kitlg

Sign In for Pricing
View Details
Clostridium Difficile Toxin B (AP)
MBS6124614-01 0.1 mL

Clostridium Difficile Toxin B (AP)

Sign In for Pricing
View Details
Clostridium Difficile Toxin B (AP)
MBS6124614-02 5x 0.1 mL

Clostridium Difficile Toxin B (AP)

Sign In for Pricing
View Details