MICAL1 Peptide - C-terminal region
MICAL1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
DKFZp434B1517, FLJ11937, FLJ21739, MICAL, MICAL-1, NICAL
UniProt
Q8TDZ2
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MICAL1 Rabbit Polyclonal Antibody (orb585173) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001152763
Preservative
Lyophilized powder
AA Sequence
WQLDQELRGYMNREENLKTAADRQAEDQVLRKLVDLVNQRDALIRFQEER
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
EHS0069 96 Tests
Horse TOX-IgG (Toxoplasma-Immunoglobulin G) ELISA Kit
Sign In for Pricing
View Details 
MBS6268600-01 0.1 mL
CD79a (CD 79a, CD79A Antigen Immunoglobulin Associated alpha, CD79a Molecule Immunoglobulin Associated alpha, B Lymphocyte Specific MB1 Protein, B cell Antigen Receptor Complex Associated Protein alpha Chain, IGA, Ig alpha, Immunoglobulin Associated Alpha
Sign In for Pricing
View Details MBS6268600-02 5x 0.1 mL
CD79a (CD 79a, CD79A Antigen Immunoglobulin Associated alpha, CD79a Molecule Immunoglobulin Associated alpha, B Lymphocyte Specific MB1 Protein, B cell Antigen Receptor Complex Associated Protein alpha Chain, IGA, Ig alpha, Immunoglobulin Associated Alpha
Sign In for Pricing
View Details 34093156 3x 1.0 µg DNA
Olr1627 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
Sign In for Pricing
View Details GTR15285690 1 Vial
Lentiviral mouse Rhot2 shRNA (UAS) - Lentiviral mouse Rhot2 shRNA (UAS) (100)
Sign In for Pricing
View Details 
MBS6356398-01 0.2 mL
TMEM151B, NT (TMEM151B, C6orf137, TMEM193, Transmembrane protein 151B, Transmembrane protein 193) (Azide free) (HRP)
Sign In for Pricing
View Details