MITD1 Peptide - middle region
MITD1 Peptide - middle region
Product Specifications
UniProt
Q8WV92
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MITD1 Rabbit Polyclonal Antibody (orb581789) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_620153
Preservative
Lyophilized powder
AA Sequence
RAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1376220-01 0.02 mg (E-Coli)
Recombinant Geobacter metallireducens UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)
Sign In for Pricing
View Details MBS1376220-02 0.02 mg (Yeast)
Recombinant Geobacter metallireducens UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)
Sign In for Pricing
View Details MBS1376220-03 0.1 mg (E-Coli)
Recombinant Geobacter metallireducens UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)
Sign In for Pricing
View Details MBS1376220-04 0.1 mg (Yeast)
Recombinant Geobacter metallireducens UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)
Sign In for Pricing
View Details MBS1376220-05 0.02 mg (Baculovirus)
Recombinant Geobacter metallireducens UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)
Sign In for Pricing
View Details MBS1376220-06 0.02 mg (Mammalian-Cell)
Recombinant Geobacter metallireducens UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)
Sign In for Pricing
View Details