MKNK1 Peptide - N-terminal region
MKNK1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MNK1
UniProt
Q9BUB5
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MKNK1 Rabbit Polyclonal Antibody (orb584649) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003675
Preservative
Lyophilized powder
AA Sequence
CQGNKNILELIEFFEDDTRFYLVFEKLQGGSILAHIQKQKHFNEREASRV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041081-100 1x 100 µL
CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740226-500 1x 500 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740806-100 1x 100 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942564-100 1x 100 µL
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2564R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details