Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MLPH Peptide - C-terminal region

MLPH Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC2771, MGC59733, SLAC2-A

UniProt

Q9BV36

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MLPH Rabbit Polyclonal Antibody (orb331049) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077006

Preservative

Lyophilized powder

AA Sequence

NLPIFLPRVAGKLGKRPEDPNADPSSEAKAMAVPYLLRRKFSNSLKSQGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPP6 siRNA (Human)
orb1867002-01 15 nmol

DPP6 siRNA (Human)

Sign In for Pricing
View Details
DPP6 siRNA (Human)
orb1867002-02 30 nmol

DPP6 siRNA (Human)

Sign In for Pricing
View Details
PAF-R Double Nickase Plasmid (m)
sc-422469-NIC 20 µg

PAF-R Double Nickase Plasmid (m)

Sign In for Pricing
View Details
CD133 (AB1721) Rabbit mAb
M3075-01 20 µL

CD133 (AB1721) Rabbit mAb

Sign In for Pricing
View Details
CD133 (AB1721) Rabbit mAb
M3075-02 50 μL

CD133 (AB1721) Rabbit mAb

Sign In for Pricing
View Details
CD133 (AB1721) Rabbit mAb
M3075-03 100 µL

CD133 (AB1721) Rabbit mAb

Sign In for Pricing
View Details