Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MLPH Peptide - C-terminal region

MLPH Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC2771, MGC59733, SLAC2-A

UniProt

Q9BV36

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MLPH Rabbit Polyclonal Antibody (orb331049) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077006

Preservative

Lyophilized powder

AA Sequence

NLPIFLPRVAGKLGKRPEDPNADPSSEAKAMAVPYLLRRKFSNSLKSQGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC80 AAV Vector (Rat) (CMV)
15312106 1 µg

CCDC80 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Rabbit Polyclonal ZNF217 Antibody [PerCP]
NBP1-78188PCP 0.1 mL

Rabbit Polyclonal ZNF217 Antibody [PerCP]

Sign In for Pricing
View Details
T-Butyl 4- (2-bromo-4-nitrophenoxy) piperidine-1-carboxylate
sc-301854 500 mg

T-Butyl 4- (2-bromo-4-nitrophenoxy) piperidine-1-carboxylate

Sign In for Pricing
View Details
Rabbit Polyclonal HBLD2 Antibody
NBP1-89715-25ul 25 µL

Rabbit Polyclonal HBLD2 Antibody

Sign In for Pricing
View Details
Mouse Nfia activation kit by CRISPRa
GA202878 1 Kit

Mouse Nfia activation kit by CRISPRa

Sign In for Pricing
View Details
4-Hydroxy-13-cis-retinoic Acid
TRC-H953395-10MG 10 mg

4-Hydroxy-13-cis-retinoic Acid

Sign In for Pricing
View Details