Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MLXIP Peptide - C-terminal region

MLXIP Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA0867, MIR, MONDOA, bHLHe36

UniProt

Q9HAP2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MLXIP Rabbit Polyclonal Antibody (orb575689) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055753

Preservative

Lyophilized powder

AA Sequence

ALSWLDQHCSLPILRPMVLSTLRQLSTSTSILTDPAQLPEQASKAVTRIG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASGEF1B Protein Vector (Mouse) (pPB-C-His)
PV222542 500 ng

RASGEF1B Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Cytokeratin 10 (LH2) Alexa Fluor® 488
sc-53252 AF488 200 µg/mL

Cytokeratin 10 (LH2) Alexa Fluor® 488

Sign In for Pricing
View Details
KPNA2 Rabbit Polyclonal Antibody (PerCP)
orb2381907 100 µL

KPNA2 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
LGALS3 Rat Monoclonal Antibody
orb2974784-01 50 µg

LGALS3 Rat Monoclonal Antibody

Sign In for Pricing
View Details
LGALS3 Rat Monoclonal Antibody
orb2974784-02 100 µg

LGALS3 Rat Monoclonal Antibody

Sign In for Pricing
View Details
Polyclonal Antibody to Ras Related C3 Botulinum Toxin Substrate 1 (Rac1)
TRV-0055664-01 20 µL

Polyclonal Antibody to Ras Related C3 Botulinum Toxin Substrate 1 (Rac1)

Sign In for Pricing
View Details