Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOBKL2A Peptide - middle region

MOBKL2A Peptide - middle region

Product Specifications

Product Name Alternative

Moblak, MOB1C, MOBKL2A

UniProt

Q96BX8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MOBKL2A Rabbit Polyclonal Antibody (orb581743) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_570719

Preservative

Lyophilized powder

AA Sequence

GSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cables2 Pre-designed siRNA Set B
SI201839B 1 Each

Rat Cables2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lentiviral human GALK1 shRNA (UAS) - Lentiviral human GALK1 shRNA (UAS, GFP) plasmid
GTR15149482 1 Vial

Lentiviral human GALK1 shRNA (UAS) - Lentiviral human GALK1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
MKI67 Antibody
CSB-PA049429 100 µL

MKI67 Antibody

Sign In for Pricing
View Details
(2S) -2-{[ (tert-Butoxy) carbonyl]amino}-3- (piperidin-4-yl) propanoic acid
TPA86613-01 50 mg

(2S) -2-{[ (tert-Butoxy) carbonyl]amino}-3- (piperidin-4-yl) propanoic acid

Sign In for Pricing
View Details
(2S) -2-{[ (tert-Butoxy) carbonyl]amino}-3- (piperidin-4-yl) propanoic acid
TPA86613-02 0.5 g

(2S) -2-{[ (tert-Butoxy) carbonyl]amino}-3- (piperidin-4-yl) propanoic acid

Sign In for Pricing
View Details
TIMM23 Protein Vector (Human) (pPB-N-His)
PV042106 500 ng

TIMM23 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details