Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOBKL2A Peptide - middle region

MOBKL2A Peptide - middle region

Product Specifications

Product Name Alternative

Moblak, MOB1C, MOBKL2A

UniProt

Q96BX8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MOBKL2A Rabbit Polyclonal Antibody (orb581743) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_570719

Preservative

Lyophilized powder

AA Sequence

GSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-methylazetidin-3-one hydrochloride
JH914885 1 Each

1-methylazetidin-3-one hydrochloride

Sign In for Pricing
View Details
Batroxobin Antibody Blocking Peptide
orb1516115 500 µg

Batroxobin Antibody Blocking Peptide

Sign In for Pricing
View Details
CSPG5 Antibody
MBS9605394-01 0.1 mL

CSPG5 Antibody

Sign In for Pricing
View Details
CSPG5 Antibody
MBS9605394-02 0.2 mL

CSPG5 Antibody

Sign In for Pricing
View Details
CSPG5 Antibody
MBS9605394-03 5x 0.2 mL

CSPG5 Antibody

Sign In for Pricing
View Details
MRPL40 Polyclonal Antibody
MBS2561058-01 0.02 mL

MRPL40 Polyclonal Antibody

Sign In for Pricing
View Details