MON1A Peptide - C-terminal region
MON1A Peptide - C-terminal region
Product Specifications
Product Name Alternative
FLJ97088, MGC13272, SAND1
UniProt
Q86VX9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MON1A Rabbit Polyclonal Antibody (orb331098) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001135973
Preservative
Lyophilized powder
AA Sequence
GIPDLRHFLYKSKSSGLFTSPEIEAPYTSEEEQERLLGLYQYLHSRAHNA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP304873M 100 µg
Munc18 1 (STXBP1) (NM_001032221) Human Recombinant Protein
Sign In for Pricing
View Details 
TAF-451-1 1 mL
Texas Red Conjugated Goat Affinity Purified Antibody to Rabbit IgG, Fc Specific
Sign In for Pricing
View Details 
E-EL-H2530-01 24 Tests
Human CD74 (HLA class II histocompatibility antigen gamma chain) ELISA Kit
Sign In for Pricing
View Details