Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MON1A Peptide - C-terminal region

MON1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ97088, MGC13272, SAND1

UniProt

Q86VX9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MON1A Rabbit Polyclonal Antibody (orb331098) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001135973

Preservative

Lyophilized powder

AA Sequence

GIPDLRHFLYKSKSSGLFTSPEIEAPYTSEEEQERLLGLYQYLHSRAHNA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Violet 500 Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09822R-01 20 Tests

Elab Fluor® Violet 500 Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09822R-02 100 Tests

Elab Fluor® Violet 500 Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09822R-03 2x 100 Tests

Elab Fluor® Violet 500 Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
CHIR-98014
TRC-C292100-1MG 1 mg

CHIR-98014

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: bilateral
CS503368 5x 5 µm

Frozen Tissue Sections, Ovary: bilateral

Sign In for Pricing
View Details
Phe-Arg-Beta-naphthylamide Dihydrochloride
TRC-P998425-25MG 25 mg

Phe-Arg-Beta-naphthylamide Dihydrochloride

Sign In for Pricing
View Details