Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MON1A Peptide - N-terminal region

MON1A Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ97088, MGC13272, SAND1

UniProt

Q86VX9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MON1A Rabbit Polyclonal Antibody (orb331099) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001135973

Preservative

Lyophilized powder

AA Sequence

TPPWVRQRAVTGTFCASWTPLRNRRAQRMATDMQRKRSSECLDGTLTPSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Imp3 Antibody
C30813-01 50 μL

Imp3 Antibody

Sign In for Pricing
View Details
Imp3 Antibody
C30813-02 100 µL

Imp3 Antibody

Sign In for Pricing
View Details
Faropenem daloxate
orb1309681-01 1 mg

Faropenem daloxate

Sign In for Pricing
View Details
Faropenem daloxate
orb1309681-02 5 mg

Faropenem daloxate

Sign In for Pricing
View Details
Faropenem daloxate
orb1309681-03 1 ml x 10 mM (in DMSO)

Faropenem daloxate

Sign In for Pricing
View Details
Faropenem daloxate
orb1309681-04 10 mg

Faropenem daloxate

Sign In for Pricing
View Details