Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MON1A Peptide - N-terminal region

MON1A Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ97088, MGC13272, SAND1

UniProt

Q86VX9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MON1A Rabbit Polyclonal Antibody (orb331099) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001135973

Preservative

Lyophilized powder

AA Sequence

TPPWVRQRAVTGTFCASWTPLRNRRAQRMATDMQRKRSSECLDGTLTPSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gastrin Releasing Peptide (GRP, BN, ProGRP, PreproGRP) (Biotin)
MBS6446692-01 0.1 mL

Gastrin Releasing Peptide (GRP, BN, ProGRP, PreproGRP) (Biotin)

Sign In for Pricing
View Details
Gastrin Releasing Peptide (GRP, BN, ProGRP, PreproGRP) (Biotin)
MBS6446692-02 5x 0.1 mL

Gastrin Releasing Peptide (GRP, BN, ProGRP, PreproGRP) (Biotin)

Sign In for Pricing
View Details
HHEX Protein Lysate (Mouse) with C-HA Tag
23243034 100 µg

HHEX Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
RSF1 (7L9) Rabbit Monoclonal Antibody
E28M3725 100 µL

RSF1 (7L9) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
STK3 (36kDa subunit) (Center) (DANRE) Rabbit pAb
MBS8555851-01 0.1 mL

STK3 (36kDa subunit) (Center) (DANRE) Rabbit pAb

Sign In for Pricing
View Details
STK3 (36kDa subunit) (Center) (DANRE) Rabbit pAb
MBS8555851-02 0.1 mL (AF405L)

STK3 (36kDa subunit) (Center) (DANRE) Rabbit pAb

Sign In for Pricing
View Details