Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MON1B Peptide - N-terminal region

MON1B Peptide - N-terminal region

Product Specifications

Product Name Alternative

HSRG1, SAND2, SRG1

UniProt

Q9NQ50

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MON1B Rabbit Polyclonal Antibody (orb585347) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003767

Preservative

Lyophilized powder

AA Sequence

TQFPSEEAREGGGVHAVPPDPEDEGLEETGSKDKDQPPSPSPPPQSEALS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-2, C-His Tag
HA210670-01 20 µg

Human IL-2, C-His Tag

Sign In for Pricing
View Details
Human IL-2, C-His Tag
HA210670-02 50 µg

Human IL-2, C-His Tag

Sign In for Pricing
View Details
Human IL-2, C-His Tag
HA210670-03 100 µg

Human IL-2, C-His Tag

Sign In for Pricing
View Details
Bromo Polystyrene
H25031509.5G 5 g

Bromo Polystyrene

Sign In for Pricing
View Details
Alpha-Amylase Microplate Assay Kit
RDSM023 100 Assays

Alpha-Amylase Microplate Assay Kit

Sign In for Pricing
View Details
Ducted Fume Hood BFSD-601
BFSD-601 1 Unit

Ducted Fume Hood BFSD-601

Sign In for Pricing
View Details