Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Morc4 Peptide - C-terminal region

Morc4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1559905

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Morc4 Rabbit Polyclonal Antibody (orb578548) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_001053814

Preservative

Lyophilized powder

AA Sequence

RSRNMAKTKNRKQLEELKRTTEKLERVLAERNLFQQKVEELEQEKNHWHS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD105 HEK293 Cell Line
E24C00304 1 Vial

Human CD105 HEK293 Cell Line

Sign In for Pricing
View Details
Human TNFRSF1A (Tumor Necrosis Factor Receptor Superfamily, Member 1A) ELISA Kit
MBS8800373-01 48 Well

Human TNFRSF1A (Tumor Necrosis Factor Receptor Superfamily, Member 1A) ELISA Kit

Sign In for Pricing
View Details
Human TNFRSF1A (Tumor Necrosis Factor Receptor Superfamily, Member 1A) ELISA Kit
MBS8800373-02 96 Well

Human TNFRSF1A (Tumor Necrosis Factor Receptor Superfamily, Member 1A) ELISA Kit

Sign In for Pricing
View Details
Human TNFRSF1A (Tumor Necrosis Factor Receptor Superfamily, Member 1A) ELISA Kit
MBS8800373-03 5x 96 Well

Human TNFRSF1A (Tumor Necrosis Factor Receptor Superfamily, Member 1A) ELISA Kit

Sign In for Pricing
View Details
Human TNFRSF1A (Tumor Necrosis Factor Receptor Superfamily, Member 1A) ELISA Kit
MBS8800373-04 10x 96 Well

Human TNFRSF1A (Tumor Necrosis Factor Receptor Superfamily, Member 1A) ELISA Kit

Sign In for Pricing
View Details
Osteopontin (HRP)
327009-01 50 µg

Osteopontin (HRP)

Sign In for Pricing
View Details