Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Morf4l1 Peptide - middle region

Morf4l1 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA4002, MGC102415, MGC103105, MGC118047, MORFRG15, MRG15, TEG-189, Tex189, mKIAA4002

UniProt

P60762

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Morf4l1 Rabbit Polyclonal Antibody (orb580132) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001034236

Preservative

Lyophilized powder

AA Sequence

LQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal LRRC63 Antibody
NBP1-90670 0.1 mL

Rabbit Polyclonal LRRC63 Antibody

Sign In for Pricing
View Details
CD98 Protein, Mouse, Recombinant (His Tag)
E45M53462M1-50 50 µg

CD98 Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
PRKACG Rabbit Polyclonal Antibody
E10G00630 100 µL

PRKACG Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Donkey Anti-Rabbit IgG(H+L), Multi-Species SP ads-CY5
MBS679427-01 1 mg

Donkey Anti-Rabbit IgG(H+L), Multi-Species SP ads-CY5

Sign In for Pricing
View Details
Donkey Anti-Rabbit IgG(H+L), Multi-Species SP ads-CY5
MBS679427-02 5x 1 mg

Donkey Anti-Rabbit IgG(H+L), Multi-Species SP ads-CY5

Sign In for Pricing
View Details
Anti-Phospho-ATM (S1987) Antibody
P00014-2 100 µL

Anti-Phospho-ATM (S1987) Antibody

Sign In for Pricing
View Details