Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Morf4l1 Peptide - middle region

Morf4l1 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA4002, MGC102415, MGC103105, MGC118047, MORFRG15, MRG15, TEG-189, Tex189, mKIAA4002

UniProt

P60762

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Morf4l1 Rabbit Polyclonal Antibody (orb580132) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001034236

Preservative

Lyophilized powder

AA Sequence

LQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MagaBio plus Virus RNA Purification Kit II
BSC87L1E-T 96 Tests

MagaBio plus Virus RNA Purification Kit II

Sign In for Pricing
View Details
2-[ (1-{[ (9H-Fluoren-9-yl) methoxy]carbonyl}piperidin-4-yl) methyl]benzoic acid
NKD13375-01 50 mg

2-[ (1-{[ (9H-Fluoren-9-yl) methoxy]carbonyl}piperidin-4-yl) methyl]benzoic acid

Sign In for Pricing
View Details
2-[ (1-{[ (9H-Fluoren-9-yl) methoxy]carbonyl}piperidin-4-yl) methyl]benzoic acid
NKD13375-02 0.5 g

2-[ (1-{[ (9H-Fluoren-9-yl) methoxy]carbonyl}piperidin-4-yl) methyl]benzoic acid

Sign In for Pricing
View Details
Human IL27RA Protein, Fc Tag
E40KMPH2139 20 µg

Human IL27RA Protein, Fc Tag

Sign In for Pricing
View Details
Mouse 9130023H24Rik (NM_177001) AAV Particle
MR213184A1V 250 µL

Mouse 9130023H24Rik (NM_177001) AAV Particle

Sign In for Pricing
View Details
5-BROMOCYTIDINE
JH669616 1 Each

5-BROMOCYTIDINE

Sign In for Pricing
View Details