Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Morf4l1 Peptide - middle region

Morf4l1 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA4002, MGC102415, MGC103105, MGC118047, MORFRG15, MRG15, TEG-189, Tex189, mKIAA4002

UniProt

P60762

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Morf4l1 Rabbit Polyclonal Antibody (orb580133) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001034236

Preservative

Lyophilized powder

AA Sequence

PEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Bone
CS707154 5x 5 µm

Tissue FFPE Sections, Bone

Sign In for Pricing
View Details
DPP4/CD26 Polyclonal Antibody
AN006840L-01 25 µL

DPP4/CD26 Polyclonal Antibody

Sign In for Pricing
View Details
DPP4/CD26 Polyclonal Antibody
AN006840L-02 100 µL

DPP4/CD26 Polyclonal Antibody

Sign In for Pricing
View Details
GCET1 (SERPINA9) Rabbit Monoclonal Antibody
TA423084 100 µL

GCET1 (SERPINA9) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
METTL15P1 Antibody
KC-3729-01 50 μL

METTL15P1 Antibody

Sign In for Pricing
View Details
METTL15P1 Antibody
KC-3729-02 100 µL

METTL15P1 Antibody

Sign In for Pricing
View Details