Morf4l1 Peptide - middle region
Morf4l1 Peptide - middle region
Product Specifications
Product Name Alternative
KIAA4002, MGC102415, MGC103105, MGC118047, MORFRG15, MRG15, TEG-189, Tex189, mKIAA4002
UniProt
P60762
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Morf4l1 Rabbit Polyclonal Antibody (orb580133) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001034236
Preservative
Lyophilized powder
AA Sequence
PEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC404483 20 µg
IKIP (IKBIP) (NM_201612) Human Over-expression Lysate
Sign In for Pricing
View Details 
![Cardiac Troponin T (TNNT2) Mouse Monoclonal Antibody [Clone ID: 1G1]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fbf24/imageurl/am06763su-n.webp)
AM06763SU-N 100 µL
Cardiac Troponin T (TNNT2) Mouse Monoclonal Antibody [Clone ID: 1G1]
Sign In for Pricing
View Details 
