Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPO Peptide - N-terminal region

MPO Peptide - N-terminal region

Product Specifications

UniProt

P05164

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MPO Rabbit Polyclonal Antibody (orb333850) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000241

Preservative

Lyophilized powder

AA Sequence

QLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMCNNRRSPTLGASNRAFVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFATC2IP (Nuclear Factor Of Activated T-Cells, Cytoplasmic, Calcineurin-Dependent 2 Interacting Protein, FLJ14639, MGC126790, MGC138387) (Not for Export EU)
130323 100 µL

NFATC2IP (Nuclear Factor Of Activated T-Cells, Cytoplasmic, Calcineurin-Dependent 2 Interacting Protein, FLJ14639, MGC126790, MGC138387) (Not for Export EU)

Sign In for Pricing
View Details
Rabbit Anti-Human SMPD3 pAb
PA4791-01 50 μL

Rabbit Anti-Human SMPD3 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human SMPD3 pAb
PA4791-02 100 μL

Rabbit Anti-Human SMPD3 pAb

Sign In for Pricing
View Details
LOC729461 siRNA (h)
sc-75638 10 µM

LOC729461 siRNA (h)

Sign In for Pricing
View Details
Lentiviral human OR52Z1 sgRNA gene knockout kit - Lentiviral human OR52Z1 sgRNA gene knockout kit (25)
GTR15359781 1 Vial

Lentiviral human OR52Z1 sgRNA gene knockout kit - Lentiviral human OR52Z1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Mouse Fxyd6 Pre-designed siRNA Set A
SI105165A 1 Each

Mouse Fxyd6 Pre-designed siRNA Set A

Sign In for Pricing
View Details