Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPPED1 Peptide - middle region

MPPED1 Peptide - middle region

Product Specifications

Product Name Alternative

239AB, C22orf1, FAM1A, FLJ50009, FLJ54633, FLJ59965, FLJ78907, MGC88045

UniProt

O15442

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MPPED1 Rabbit Polyclonal Antibody (orb585394) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001037835

Preservative

Lyophilized powder

AA Sequence

YEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal TLR9 Antibody (2A4C6.2E5) [PE]
NBP2-31150PE 0.1 mL

Rat Monoclonal TLR9 Antibody (2A4C6.2E5) [PE]

Sign In for Pricing
View Details
KMT4 Rabbit pAb, Pacific Blue conjugated
orb2847909 100 µL

KMT4 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
L-740093
HY-125692 1 Each

L-740093

Sign In for Pricing
View Details
3PS-750-2-WT-SC AB Labels
114241 Roll of 100 Piece(s)

3PS-750-2-WT-SC AB Labels

Sign In for Pricing
View Details
Rabbit Monoclonal NKX2.2 Antibody (NX2/1422R) [Janelia Fluor 646]
NBP3-11619JF646 0.1 mL

Rabbit Monoclonal NKX2.2 Antibody (NX2/1422R) [Janelia Fluor 646]

Sign In for Pricing
View Details
Phospho-HSL (Ser660) Antibody
AF8026-01 100 µL

Phospho-HSL (Ser660) Antibody

Sign In for Pricing
View Details