Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPPED1 Peptide - middle region

MPPED1 Peptide - middle region

Product Specifications

Product Name Alternative

239AB, C22orf1, FAM1A, FLJ50009, FLJ54633, FLJ59965, FLJ78907, MGC88045

UniProt

O15442

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MPPED1 Rabbit Polyclonal Antibody (orb585394) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001037835

Preservative

Lyophilized powder

AA Sequence

YEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mpv17l Mouse shRNA Lentiviral Particle (Locus ID 93734)
TL512459V 500 µL Each

Mpv17l Mouse shRNA Lentiviral Particle (Locus ID 93734)

Sign In for Pricing
View Details
GLYATL1 (NM_001220494) Human Tagged ORF Clone
RG232419 10 µg

GLYATL1 (NM_001220494) Human Tagged ORF Clone

Sign In for Pricing
View Details
5' 6-FAM / 3' ECLIPSE
orb532770 5 to 9 nmol

5' 6-FAM / 3' ECLIPSE

Sign In for Pricing
View Details
IL11RA-set siRNA/shRNA/RNAi Lentivector (Human)
24811091 4x 500 ng

IL11RA-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Abemaciclib Impurity 2
RM-A305002-01 10 mg

Abemaciclib Impurity 2

Sign In for Pricing
View Details
Abemaciclib Impurity 2
RM-A305002-02 25 mg

Abemaciclib Impurity 2

Sign In for Pricing
View Details