Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRE11 Peptide - N-terminal region

MRE11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ATLD, HNGS1, MRE11A, MRE11B

UniProt

P49959

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRE11 Rabbit Polyclonal Antibody (orb583244) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005582

Preservative

Lyophilized powder

AA Sequence

DTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRKTLHTCLELLRKYCM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hiat1 3'UTR GFP Stable Cell Line
TU159494 1.0 mL

Hiat1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
C-raf Antibody
25129 100 µL

C-raf Antibody

Sign In for Pricing
View Details
CACNB3 Peptide - N-terminal region (AAP34958)
AAP34958-100UG 100 µg

CACNB3 Peptide - N-terminal region (AAP34958)

Sign In for Pricing
View Details
Mouse Neuronal PAS domain-containing protein 4, Npas4 ELISA KIT
ELI-22103m 96 Tests

Mouse Neuronal PAS domain-containing protein 4, Npas4 ELISA KIT

Sign In for Pricing
View Details
Human CEP57 Pre-designed siRNA Set B
SI002847B 1 Each

Human CEP57 Pre-designed siRNA Set B

Sign In for Pricing
View Details
6330527O06Rik sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3555103 1.0 µg DNA

6330527O06Rik sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details