Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRGPRE Peptide - C-terminal region

MRGPRE Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR167, MGC138408, MRGE

UniProt

Q86SM8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRGPRE Rabbit Polyclonal Antibody (orb585484) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001034254

Preservative

Lyophilized powder

AA Sequence

AAKPVVYFCLGSAQGRRLPLRLVLQRALGDEAELGAVRETSRRGLVDIAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF428 Lentiviral Activation Particles (h2)
sc-414265-LAC-2 200 µL

ZNF428 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Mouse Cardiotrophin 1
RC444051 10 µg

Mouse Cardiotrophin 1

Sign In for Pricing
View Details
Rabbit Monoclonal BCMA/TNFRSF17 Antibody (CD269/8508R) [DyLight 488]
NBP3-20821G 0.1 mL

Rabbit Monoclonal BCMA/TNFRSF17 Antibody (CD269/8508R) [DyLight 488]

Sign In for Pricing
View Details
LMAN1 Knockout AGS Polyclonal Cells
ARG3140 1 Million

LMAN1 Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
OAZ3 siRNA (Human)
CRH9899-01 15 nmol

OAZ3 siRNA (Human)

Sign In for Pricing
View Details
OAZ3 siRNA (Human)
CRH9899-02 30 nmol

OAZ3 siRNA (Human)

Sign In for Pricing
View Details