Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRGPRE Peptide - C-terminal region

MRGPRE Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR167, MGC138408, MRGE

UniProt

Q86SM8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRGPRE Rabbit Polyclonal Antibody (orb585484) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001034254

Preservative

Lyophilized powder

AA Sequence

AAKPVVYFCLGSAQGRRLPLRLVLQRALGDEAELGAVRETSRRGLVDIAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC2 (NM_005431) Human Over-expression Lysate
LH07702V 100 µg

XRCC2 (NM_005431) Human Over-expression Lysate

Sign In for Pricing
View Details
MGluR-7 discontinued
538958-01 30ul

MGluR-7 discontinued

Sign In for Pricing
View Details
MGluR-7 discontinued
538958-02 100 µL

MGluR-7 discontinued

Sign In for Pricing
View Details
OR4M1 Human Over-expression Lysate
orb1342375 100 µg

OR4M1 Human Over-expression Lysate

Sign In for Pricing
View Details
MARCO Antibody (YA6907, Rabbit)
HY-P87219 1 Each

MARCO Antibody (YA6907, Rabbit)

Sign In for Pricing
View Details
Recombinant Human Trimethyllysine dioxygenase, mitochondrial (TMLHE)
orb1652640-01 20 µg

Recombinant Human Trimethyllysine dioxygenase, mitochondrial (TMLHE)

Sign In for Pricing
View Details