Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRGPRF Peptide - C-terminal region

MRGPRF Peptide - C-terminal region

Product Specifications

Product Name Alternative

RTA, MRGF, GPR140, GPR168, FLJ16111, FLJ29034, FLJ40998, FLJ53714, MGC21621, DKFZp586B2122, MRGPRF, mrgF

UniProt

Q96AM1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRGPRF Rabbit Polyclonal Antibody (orb584509) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659452

Preservative

Lyophilized powder

AA Sequence

PCLALILHVECRARRRQRSAKLNHVILAMVSVFLVSSIYLGIDWFLFWVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNKSR1 Rabbit pAb
E47R8028 100 µL

CNKSR1 Rabbit pAb

Sign In for Pricing
View Details
GCIP interacting protein p29 (SYF2) (NM_015484) Human Tagged ORF Clone
RG202167 10 µg

GCIP interacting protein p29 (SYF2) (NM_015484) Human Tagged ORF Clone

Sign In for Pricing
View Details
SLC25A12 (Calcium-Binding Mitochondrial Carrier Protein Aralar1, Mitochondrial aspartate Glutamate Carrier 1, Solute Carrier Family 25 Member 12, ARALAR1) discontinued
225849-01 50 µL

SLC25A12 (Calcium-Binding Mitochondrial Carrier Protein Aralar1, Mitochondrial aspartate Glutamate Carrier 1, Solute Carrier Family 25 Member 12, ARALAR1) discontinued

Sign In for Pricing
View Details
SLC25A12 (Calcium-Binding Mitochondrial Carrier Protein Aralar1, Mitochondrial aspartate Glutamate Carrier 1, Solute Carrier Family 25 Member 12, ARALAR1) discontinued
225849-02 100 µL

SLC25A12 (Calcium-Binding Mitochondrial Carrier Protein Aralar1, Mitochondrial aspartate Glutamate Carrier 1, Solute Carrier Family 25 Member 12, ARALAR1) discontinued

Sign In for Pricing
View Details
MMP2 (Matrix Metalloproteinase 2, CLG4, MONA, CLG4A, TBE-1, MMP-II) (FITC)
MBS6426950-01 0.1 mL

MMP2 (Matrix Metalloproteinase 2, CLG4, MONA, CLG4A, TBE-1, MMP-II) (FITC)

Sign In for Pricing
View Details
MMP2 (Matrix Metalloproteinase 2, CLG4, MONA, CLG4A, TBE-1, MMP-II) (FITC)
MBS6426950-02 5x 0.1 mL

MMP2 (Matrix Metalloproteinase 2, CLG4, MONA, CLG4A, TBE-1, MMP-II) (FITC)

Sign In for Pricing
View Details