Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRGPRF Peptide - C-terminal region

MRGPRF Peptide - C-terminal region

Product Specifications

Product Name Alternative

RTA, MRGF, GPR140, GPR168, FLJ16111, FLJ29034, FLJ40998, FLJ53714, MGC21621, DKFZp586B2122, MRGPRF, mrgF

UniProt

Q96AM1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRGPRF Rabbit Polyclonal Antibody (orb584509) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659452

Preservative

Lyophilized powder

AA Sequence

PCLALILHVECRARRRQRSAKLNHVILAMVSVFLVSSIYLGIDWFLFWVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue&Cell RNA/DNA Kit(Spin Column)
2105A 20 Tests

Tissue&Cell RNA/DNA Kit(Spin Column)

Sign In for Pricing
View Details
Histone H2B (TriMethyl-K5) Rabbit Polyclonal Antibody
orb334685-01 30 µL

Histone H2B (TriMethyl-K5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H2B (TriMethyl-K5) Rabbit Polyclonal Antibody
orb334685-02 50 μL

Histone H2B (TriMethyl-K5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H2B (TriMethyl-K5) Rabbit Polyclonal Antibody
orb334685-03 100 µL

Histone H2B (TriMethyl-K5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H2B (TriMethyl-K5) Rabbit Polyclonal Antibody
orb334685-04 200 µL

Histone H2B (TriMethyl-K5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MFSD7 siRNA (Human)
MBS827181-01 15 nmol

MFSD7 siRNA (Human)

Sign In for Pricing
View Details