Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL1 Peptide - N-terminal region

MRPL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BM022, FLJ96680, L1MT, MRP-L1

UniProt

Q9BYD6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL1 Rabbit Polyclonal Antibody (orb585447) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064621

Preservative

Lyophilized powder

AA Sequence

KKTKKGAKEKTPDEKKDEIEKIKAYPYMEGEPEDDVYLKRLYPRQIYEVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Pentylphenol
TRC-P283875-1G 1 g

4-Pentylphenol

Sign In for Pricing
View Details
Chymotrypsin like protease (CTRL) (NM_001907) Human Recombinant Protein
TP309072 20 µg

Chymotrypsin like protease (CTRL) (NM_001907) Human Recombinant Protein

Sign In for Pricing
View Details
Human FGFBP2 Antibody Pair Set
E-KAB-0538 50 µL & 100 µg

Human FGFBP2 Antibody Pair Set

Sign In for Pricing
View Details
Mouse Rgs4 activation kit by CRISPRa
GA203634 1 Kit

Mouse Rgs4 activation kit by CRISPRa

Sign In for Pricing
View Details
Chenodeoxycholic Acid 24-Acyl-Beta-D-glucuronide
TRC-C291910-5MG 5 mg

Chenodeoxycholic Acid 24-Acyl-Beta-D-glucuronide

Sign In for Pricing
View Details
CLECSF6 (CLEC4A) (NM_016184) Human Over-expression Lysate
LC402515 20 µg

CLECSF6 (CLEC4A) (NM_016184) Human Over-expression Lysate

Sign In for Pricing
View Details