MRPL1 Peptide - N-terminal region
MRPL1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
BM022, FLJ96680, L1MT, MRP-L1
UniProt
Q9BYD6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MRPL1 Rabbit Polyclonal Antibody (orb585447) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_064621
Preservative
Lyophilized powder
AA Sequence
KKTKKGAKEKTPDEKKDEIEKIKAYPYMEGEPEDDVYLKRLYPRQIYEVE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042166-100 1x 100 µL
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC401752 20 µg
Elastase 3A (CELA3A) (NM_005747) Human Over-expression Lysate
Sign In for Pricing
View Details 
TRC-G245503-50G 50 g
Garlic Extract (Contains Diallyl Trisulfide, Technical Grade)
Sign In for Pricing
View Details 
