Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL19 Peptide - C-terminal region

MRPL19 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA0104, L19mt, MGC20675, MRP-L15, MRP-L19, MRPL15, RLX1, RPML15

UniProt

P49406

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL19 Rabbit Polyclonal Antibody (orb585237) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055578

Preservative

Lyophilized powder

AA Sequence

PWSKRWERPNFNIKGIRFDLCLTEQQMKEAQKWNQPWLEFDMMREYDTSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal GFAP Antibody (GFAP/8255R) [Alexa Fluor 488]
NBP3-24051AF488 0.1 mL

Rabbit Monoclonal GFAP Antibody (GFAP/8255R) [Alexa Fluor 488]

Sign In for Pricing
View Details
Lamin A Antibody
orb3074216 0.1 mL

Lamin A Antibody

Sign In for Pricing
View Details
GTF2H2 AAV Vector (Mouse) (CMV)
22793104 1 µg

GTF2H2 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Dhx36 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6520305 3x 1.0 µg

Dhx36 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
GC Column, H1-17, 60m*0.32mm*0.25μm, 1pc/pk
14011200 1 PC

GC Column, H1-17, 60m*0.32mm*0.25μm, 1pc/pk

Sign In for Pricing
View Details
VAMP1 Rabbit pAb
orb2717935-01 50 µL

VAMP1 Rabbit pAb

Sign In for Pricing
View Details