Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL19 Peptide - C-terminal region

MRPL19 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA0104, L19mt, MGC20675, MRP-L15, MRP-L19, MRPL15, RLX1, RPML15

UniProt

P49406

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL19 Rabbit Polyclonal Antibody (orb585237) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055578

Preservative

Lyophilized powder

AA Sequence

PWSKRWERPNFNIKGIRFDLCLTEQQMKEAQKWNQPWLEFDMMREYDTSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Salmonella typhi tRNA-dihydrouridine synthase C (dusC)
MBS1420669-01 0.02 mg (E-Coli)

Recombinant Salmonella typhi tRNA-dihydrouridine synthase C (dusC)

Sign In for Pricing
View Details
Recombinant Salmonella typhi tRNA-dihydrouridine synthase C (dusC)
MBS1420669-02 0.02 mg (Yeast)

Recombinant Salmonella typhi tRNA-dihydrouridine synthase C (dusC)

Sign In for Pricing
View Details
Recombinant Salmonella typhi tRNA-dihydrouridine synthase C (dusC)
MBS1420669-03 0.1 mg (E-Coli)

Recombinant Salmonella typhi tRNA-dihydrouridine synthase C (dusC)

Sign In for Pricing
View Details
Recombinant Salmonella typhi tRNA-dihydrouridine synthase C (dusC)
MBS1420669-04 0.1 mg (Yeast)

Recombinant Salmonella typhi tRNA-dihydrouridine synthase C (dusC)

Sign In for Pricing
View Details
Recombinant Salmonella typhi tRNA-dihydrouridine synthase C (dusC)
MBS1420669-05 0.02 mg (Baculovirus)

Recombinant Salmonella typhi tRNA-dihydrouridine synthase C (dusC)

Sign In for Pricing
View Details
Recombinant Salmonella typhi tRNA-dihydrouridine synthase C (dusC)
MBS1420669-06 0.02 mg (Mammalian-Cell)

Recombinant Salmonella typhi tRNA-dihydrouridine synthase C (dusC)

Sign In for Pricing
View Details