Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mrpl21 Peptide - middle region

Mrpl21 Peptide - middle region

Product Specifications

Product Name Alternative

BC028768, MGC41352

UniProt

A8Y5G2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mrpl21 Rabbit Polyclonal Antibody (orb577942) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_758456

Preservative

Lyophilized powder

AA Sequence

LPDPVEETRHHAEVVKRVNELIATGQYGRLFAVVHFASHQWKVTAEDLIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AICDA Recombinant Protein (Human)
RP000829 100 µg

AICDA Recombinant Protein (Human)

Sign In for Pricing
View Details
MMP-12 (G-2) : m-IgG1 BP-HRP Bundle
sc-543975 1 Kit

MMP-12 (G-2) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
APCS Adenovirus (Mouse)
12138054 1.0 mL

APCS Adenovirus (Mouse)

Sign In for Pricing
View Details
Phospho-FHOD1 (Thr1141) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-13159R-BF555 100 µL

Phospho-FHOD1 (Thr1141) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
NDUFS6 discontinued
344620-01 100 µL

NDUFS6 discontinued

Sign In for Pricing
View Details
NDUFS6 discontinued
344620-02 200 µL

NDUFS6 discontinued

Sign In for Pricing
View Details