Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL3 Peptide - N-terminal region

MRPL3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MRL3, RPML3

UniProt

P09001

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL3 Rabbit Polyclonal Antibody (orb331191) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009139

Preservative

Lyophilized powder

AA Sequence

THIWLFVRGLHGKSGTWWDEHLSEENVPFIKQLVSDEDKAQLASKLCPLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ApoC1 Rabbit mAb
E2R389018 100 µL

ApoC1 Rabbit mAb

Sign In for Pricing
View Details
Human TXNDC12 Protein
E40KMPH6474 20 µg

Human TXNDC12 Protein

Sign In for Pricing
View Details
Biotin-11-dUTP, 250 nmol
1553-250nmol 250 nmol

Biotin-11-dUTP, 250 nmol

Sign In for Pricing
View Details
Mouse Monoclonal CGRP Antibody (5) [DyLight 680]
NBP3-00518FR 0.1 mL

Mouse Monoclonal CGRP Antibody (5) [DyLight 680]

Sign In for Pricing
View Details
Nxf7 (NM_130888) Mouse Tagged ORF Clone Lentiviral Particle
MR215376L4V 200 µL

Nxf7 (NM_130888) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Calretinin (CALB2) Antibody
abx135751-01 60 µL

Calretinin (CALB2) Antibody

Sign In for Pricing
View Details