Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL3 Peptide - N-terminal region

MRPL3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MRL3, RPML3

UniProt

P09001

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL3 Rabbit Polyclonal Antibody (orb331191) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009139

Preservative

Lyophilized powder

AA Sequence

THIWLFVRGLHGKSGTWWDEHLSEENVPFIKQLVSDEDKAQLASKLCPLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gimap4 (NM_173153) Rat Tagged ORF Clone
RR201507 10 µg

Gimap4 (NM_173153) Rat Tagged ORF Clone

Sign In for Pricing
View Details
N- (4- (3,4-dichlorophenyl) (2,5-thiazolyl) ) -3-pyridylformamide
VRA09003 250 mg

N- (4- (3,4-dichlorophenyl) (2,5-thiazolyl) ) -3-pyridylformamide

Sign In for Pricing
View Details
Y-27632 2HCl 100mg
A11001-100 100 mg

Y-27632 2HCl 100mg

Sign In for Pricing
View Details
Cable S7/BNC 1 meter
1001733 1 Each

Cable S7/BNC 1 meter

Sign In for Pricing
View Details
HOXC10-set siRNA/shRNA/RNAi Lentivector (Human)
23830091 4x 500 ng

HOXC10-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
AICAR, AMPK activator
TBI1092-250MG 250 mg

AICAR, AMPK activator

Sign In for Pricing
View Details