Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL45 Peptide - C-terminal region

MRPL45 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC11321, L45mt, MRP-L45

UniProt

Q9BRJ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL45 Rabbit Polyclonal Antibody (orb584693) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115727

Preservative

Lyophilized powder

AA Sequence

RFGRLMYGQEDVPKDVLEYVVFEKQLTNPYGSWRMHTKIVPPWAPPKQPI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX10 (SOX10/992), CF568 conjugate, 0.1mg/mL
BNC680992-500 1x 500 µL

SOX10 (SOX10/992), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Galectin-3/LGALS3 Protein (His Tag)
PKSH032473-01 10 µg

Recombinant Human Galectin-3/LGALS3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Galectin-3/LGALS3 Protein (His Tag)
PKSH032473-02 50 µg

Recombinant Human Galectin-3/LGALS3 Protein (His Tag)

Sign In for Pricing
View Details
Cyclin D1 (CCND1/809), 0.2mg/mL
BNUB0809-100 1x 100 µL

Cyclin D1 (CCND1/809), 0.2mg/mL

Sign In for Pricing
View Details
Carboxy Polystyrene
H40045008.100G 100 g

Carboxy Polystyrene

Sign In for Pricing
View Details
Rassf3 Mouse Gene Knockout Kit (CRISPR)
KN514517 1 Kit

Rassf3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details