Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL45 Peptide - C-terminal region

MRPL45 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC11321, L45mt, MRP-L45

UniProt

Q9BRJ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL45 Rabbit Polyclonal Antibody (orb584693) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115727

Preservative

Lyophilized powder

AA Sequence

RFGRLMYGQEDVPKDVLEYVVFEKQLTNPYGSWRMHTKIVPPWAPPKQPI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRR20D (NM_001130406) Human Over-expression Lysate
LC427200 20 µg

PRR20D (NM_001130406) Human Over-expression Lysate

Sign In for Pricing
View Details
Purified Anti-Human CD19 Antibody[HI19a]
E-AB-F1304A-01 25 µg

Purified Anti-Human CD19 Antibody[HI19a]

Sign In for Pricing
View Details
Purified Anti-Human CD19 Antibody[HI19a]
E-AB-F1304A-02 100 µg

Purified Anti-Human CD19 Antibody[HI19a]

Sign In for Pricing
View Details
NET1 (NM_005863) Human Over-expression Lysate
LC401777 20 µg

NET1 (NM_005863) Human Over-expression Lysate

Sign In for Pricing
View Details
IHO1 Rabbit Polyclonal Antibody
TA366680 100 µL

IHO1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SATB2 Recombinant Rabbit Monoclonal Antibody [JE02-88]
HA722751 100 µL

SATB2 Recombinant Rabbit Monoclonal Antibody [JE02-88]

Sign In for Pricing
View Details