Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL46 Peptide - C-terminal region

MRPL46 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C15orf4, LIECG2, MGC22762, P2ECSL

UniProt

Q9H2W6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL46 Rabbit Polyclonal Antibody (orb585450) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071446

Preservative

Lyophilized powder

AA Sequence

KVFFFKALLLTGDFSQAGNKGHHVWVTKDELGDYLKPKYLAQVRRFVSDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DREF (ZBED1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D5]
TA505069AM 100 µL

DREF (ZBED1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D5]

Sign In for Pricing
View Details
Dystrobrevin beta (DTNB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E6]
TA504325BM 100 µL

Dystrobrevin beta (DTNB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E6]

Sign In for Pricing
View Details
Delta-9,11-promestriene
TRC-D231673-25MG 25 mg

Delta-9,11-promestriene

Sign In for Pricing
View Details
Furfuryl Alcohol
TRC-F864220-5G 5 g

Furfuryl Alcohol

Sign In for Pricing
View Details
PBDE 119
TRC-P215250-50MG 50 mg

PBDE 119

Sign In for Pricing
View Details
USP43 Human Gene Knockout Kit (CRISPR)
KN418571 1 Kit

USP43 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details