Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL46 Peptide - C-terminal region

MRPL46 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C15orf4, LIECG2, MGC22762, P2ECSL

UniProt

Q9H2W6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL46 Rabbit Polyclonal Antibody (orb585450) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071446

Preservative

Lyophilized powder

AA Sequence

KVFFFKALLLTGDFSQAGNKGHHVWVTKDELGDYLKPKYLAQVRRFVSDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Nose
CS803338 5x 5 µm

Tissue FFPE Sections, Nose

Sign In for Pricing
View Details
N-Acetyl N-Penta-cbz Neomycin B
TRC-A178335-5MG 5 mg

N-Acetyl N-Penta-cbz Neomycin B

Sign In for Pricing
View Details
Polystyrene AM RAM
H25031523.5G 5 g

Polystyrene AM RAM

Sign In for Pricing
View Details
CD4 (EDU-2), CF488A conjugate, 0.1mg/mL
BNC880345-100 1x 100 µL

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vat1 Mouse Gene Knockout Kit (CRISPR)
KN518859 1 Kit

Vat1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tau (S324) Antibody
KC-36377-01 50 μL

Tau (S324) Antibody

Sign In for Pricing
View Details