Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL49 Peptide - N-terminal region

MRPL49 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C11orf4, L49mt, MGC10656, NOF, NOF1, MRP-L49

UniProt

Q13405

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL49 Rabbit Polyclonal Antibody (orb584564) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004918

Preservative

Lyophilized powder

AA Sequence

IMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue, Total Protein, Mouse Adult Normal, Heart HisTekTM
T5595-7093 1 mg

Tissue, Total Protein, Mouse Adult Normal, Heart HisTekTM

Sign In for Pricing
View Details
Ndor1 ORF Vector (Mouse) (pORF)
ORF051133 1.0 µg DNA

Ndor1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
CD79B Antibody, HRP conjugated
A16641-50UG 50 µg

CD79B Antibody, HRP conjugated

Sign In for Pricing
View Details
HEXA ELISA Kit (Mouse) (OKAN06036)
OKAN06036 96 Well

HEXA ELISA Kit (Mouse) (OKAN06036)

Sign In for Pricing
View Details
CCKBR Peptide
45-378P 0.1 mg

CCKBR Peptide

Sign In for Pricing
View Details
SPA-1 (E-6) : m-IgGκ BP-HRP Bundle
sc-534851 1 Kit

SPA-1 (E-6) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details