Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mrpl55 Peptide - N-terminal region

Mrpl55 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2810038N09Rik

UniProt

Q7Z7F7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mrpl55 Rabbit Polyclonal Antibody (orb582056) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_852106

Preservative

Lyophilized powder

AA Sequence

PRHLHTSPWRADCSRASLTRLRRQAYARLYPVLLVKQDGSTIHIRYREPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-GR Antibody, Affinity Purified
MBS3903667-01 0.01 mg

Rabbit anti-GR Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-GR Antibody, Affinity Purified
MBS3903667-02 0.1 mg

Rabbit anti-GR Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-GR Antibody, Affinity Purified
MBS3903667-03 5x 0.01 mg

Rabbit anti-GR Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-GR Antibody, Affinity Purified
MBS3903667-04 5x 0.1 mg

Rabbit anti-GR Antibody, Affinity Purified

Sign In for Pricing
View Details
KCNA7 3'UTR Lenti-reporter-Luc Vector
25331081 1.0 µg

KCNA7 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Rabbit anti-SRBDl Antibody, Affinity Purified
A305-121A-T 10 µg

Rabbit anti-SRBDl Antibody, Affinity Purified

Sign In for Pricing
View Details