Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mrpl55 Peptide - N-terminal region

Mrpl55 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2810038N09Rik

UniProt

Q7Z7F7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mrpl55 Rabbit Polyclonal Antibody (orb582056) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_852106

Preservative

Lyophilized powder

AA Sequence

PRHLHTSPWRADCSRASLTRLRRQAYARLYPVLLVKQDGSTIHIRYREPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NALP1 (NLRP1) (NM_014922) Human Tagged Lenti ORF Clone
RC216538L3 10 µg

NALP1 (NLRP1) (NM_014922) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Claudin 7 (CLDN7) (NM_001185023) Human Over-expression Lysate
LY432582 100 µg

Claudin 7 (CLDN7) (NM_001185023) Human Over-expression Lysate

Sign In for Pricing
View Details
Reelin Rabbit Polyclonal Antibody (BF680)
orb2504501 100 µL

Reelin Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Tissue Total RNA, Adrenal gland
CR561965 5 µg

Tissue Total RNA, Adrenal gland

Sign In for Pricing
View Details
Batrachochytrium dendrobatidis Probe-based qPCR Kit
MK1F588-01 48 Test

Batrachochytrium dendrobatidis Probe-based qPCR Kit

Sign In for Pricing
View Details
Batrachochytrium dendrobatidis Probe-based qPCR Kit
MK1F588-02 50 Tests

Batrachochytrium dendrobatidis Probe-based qPCR Kit

Sign In for Pricing
View Details