Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL55 Peptide - middle region

MRPL55 Peptide - middle region

Product Specifications

Product Name Alternative

AAVG5835, DKFZp686D1387, L55nt, MGC61802, MRP-L55, PRO19675

UniProt

D4ACI9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL55 Rabbit Polyclonal Antibody (orb582057) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100736

Preservative

Lyophilized powder

AA Sequence

TIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSD

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPHX2 Rabbit Polyclonal Antibody (Fluoro647)
orb3112003 100 µg

EPHX2 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Snx29 (NM_028964) Mouse Tagged Lenti ORF Clone
MR223260L4 10 µg

Snx29 (NM_028964) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human RPS6KA1 Protein, N-His
orb2821076-01 20 µg

Recombinant Human RPS6KA1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RPS6KA1 Protein, N-His
orb2821076-02 50 µg

Recombinant Human RPS6KA1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RPS6KA1 Protein, N-His
orb2821076-03 100 µg

Recombinant Human RPS6KA1 Protein, N-His

Sign In for Pricing
View Details
SESN3 antibody
MBS9405335-01 0.1 mL

SESN3 antibody

Sign In for Pricing
View Details