Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL55 Peptide - middle region

MRPL55 Peptide - middle region

Product Specifications

Product Name Alternative

AAVG5835, DKFZp686D1387, L55nt, MGC61802, MRP-L55, PRO19675

UniProt

D4ACI9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL55 Rabbit Polyclonal Antibody (orb582057) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100736

Preservative

Lyophilized powder

AA Sequence

TIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD133 CRISPR Activation Plasmid (h2)
sc-418263-ACT-2 20 µg

CD133 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
NSC 632839 hydrochloride
A4004-10 10 mg

NSC 632839 hydrochloride

Sign In for Pricing
View Details
GlyR β (G-1) : m-IgG1 BP-HRP Bundle
sc-545506 1 Kit

GlyR β (G-1) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Lentiviral mouse Tprkb shRNA (UAS) - Lentiviral mouse Tprkb shRNA (UAS) (100)
GTR15255354 1 Vial

Lentiviral mouse Tprkb shRNA (UAS) - Lentiviral mouse Tprkb shRNA (UAS) (100)

Sign In for Pricing
View Details
Rotavirus, Capsid Protein discontinued
R3000-08F 100 µg

Rotavirus, Capsid Protein discontinued

Sign In for Pricing
View Details
Mouse Monoclonal CUGBP2 Antibody (PCRP-CELF2-1E4) [Alexa Fluor 405]
NBP3-14271AF405 0.1 mL

Mouse Monoclonal CUGBP2 Antibody (PCRP-CELF2-1E4) [Alexa Fluor 405]

Sign In for Pricing
View Details