MRPS11 Peptide - middle region
MRPS11 Peptide - middle region
Product Specifications
Product Name Alternative
FLJ22512, FLJ23406, HCC-2
UniProt
E7EP84
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MRPS11 Rabbit Polyclonal Antibody (orb585372) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001139310
Preservative
Lyophilized powder
AA Sequence
GTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15181917 1 Vial
Lentiviral mouse Nxn shRNA (UAS) - Lentiviral mouse Nxn shRNA (UAS, GFP) (100)
Sign In for Pricing
View Details 
MBS8116280-01 0.3 mg
Mouse CD166/ALCAM HEK293 Overexpression Lysate
Sign In for Pricing
View Details MBS8116280-02 5x 0.3 mg
Mouse CD166/ALCAM HEK293 Overexpression Lysate
Sign In for Pricing
View Details P505315 100 µg
JEV NS1/Non-structural 1 Protein (C-His, Japanese encephalitis virus (strain M28) (JEV) )
Sign In for Pricing
View Details