Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS11 Peptide - middle region

MRPS11 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ22512, FLJ23406, HCC-2

UniProt

E7EP84

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS11 Rabbit Polyclonal Antibody (orb585372) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139310

Preservative

Lyophilized powder

AA Sequence

GTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl 2-chloro-4H-thieno[3,2-b]pyrrole-5-carboxylate
DRA86008-01 50 mg

Methyl 2-chloro-4H-thieno[3,2-b]pyrrole-5-carboxylate

Sign In for Pricing
View Details
Methyl 2-chloro-4H-thieno[3,2-b]pyrrole-5-carboxylate
DRA86008-02 0.5 g

Methyl 2-chloro-4H-thieno[3,2-b]pyrrole-5-carboxylate

Sign In for Pricing
View Details
PDCD1/CD279/PD-1 Antibody
orb1537054 50 μL

PDCD1/CD279/PD-1 Antibody

Sign In for Pricing
View Details
MPR beta Rabbit Polyclonal Antibody
orb1880370-01 30 µL

MPR beta Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MPR beta Rabbit Polyclonal Antibody
orb1880370-02 50 µL

MPR beta Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MPR beta Rabbit Polyclonal Antibody
orb1880370-03 100 µL

MPR beta Rabbit Polyclonal Antibody

Sign In for Pricing
View Details