Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS18B Peptide - N-terminal region

MRPS18B Peptide - N-terminal region

Product Specifications

Product Name Alternative

C6orf14, DKFZp564H0223, HSPC183, HumanS18a, MRP-S18-2, MRPS18-2, PTD017, S18amt

UniProt

Q9Y676

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS18B Rabbit Polyclonal Antibody (orb585451) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_054765

Preservative

Lyophilized powder

AA Sequence

SVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibin beta B (INHBB) Rabbit Polyclonal Antibody
TA361310 100 µL

Inhibin beta B (INHBB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ki67 Rabbit monoclonal antibody
BS40169 50ul

Ki67 Rabbit monoclonal antibody

Sign In for Pricing
View Details
VILIP1 Antibody
orb1318575 100 µL

VILIP1 Antibody

Sign In for Pricing
View Details
Lentiviral human RABGGTB shRNA (UAS) - Lentiviral human RABGGTB shRNA (UAS) plasmid
GTR15125635 1 Vial

Lentiviral human RABGGTB shRNA (UAS) - Lentiviral human RABGGTB shRNA (UAS) plasmid

Sign In for Pricing
View Details
Lentiviral human SEPHS2 sgRNA gene knockout kit - Lentiviral human SEPHS2 sgRNA gene knockout kit (100)
GTR15400612 1 Vial

Lentiviral human SEPHS2 sgRNA gene knockout kit - Lentiviral human SEPHS2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Recombinant human COPZ1 protein
ATGP1048-010 10 µg

Recombinant human COPZ1 protein

Sign In for Pricing
View Details